PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G064200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB_related
Protein Properties Length: 388aa    MW: 41912.6 Da    PI: 6.4124
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G064200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.9e-1697141147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r rW+teE+ ++vda  ++G + Wk+I +++g ++t  q++s+ qky
  Sobic.003G064200.2.p  97 RERWSTEEHGRFVDALLMFGRD-WKKIEEHVG-TKTTIQIRSHAQKY 141
                           78******************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.66E-1791147IPR009057Homeodomain-like
PROSITE profilePS5129417.51992146IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-994148IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-1695144IPR006447Myb domain, plants
SMARTSM007178.0E-996144IPR001005SANT/Myb domain
PfamPF002493.8E-1297141IPR001005SANT/Myb domain
CDDcd001671.01E-699142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MVTEQHELAS CPIPTPDGSC FSSSLPCSSR LYRIVYIPGR AFGDGDRCPF VPICCCCCCC  60
WFVERDYSRG SSSSSSMDSN EMPGKKARKP YTITKPRERW STEEHGRFVD ALLMFGRDWK  120
KIEEHVGTKT TIQIRSHAQK YFLKVQKLGL AAGLPPMYPR RHFAMQQQEQ QQTTVAGSSA  180
AAAAMPLLHG LQQQQPMCAP VAMPGLSESD AVAHGSSIGW NSPGVLPAPS SEMQGLDWAA  240
GPSASGTAPL MNTDAQSQIV PLAGGGRFIG APSLSSTSID WAGSGSSNAS EASAIGAVHD  300
EPIELPLSPE DLPFAQVYRF VGDMFDPNTP IPVETHLQKL KELDDITVKT ILLVLRNLEN  360
NLSAPQFEPV RRLLSTYDPT RGVSGQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693306e-88BT069330.2 Zea mays full-length cDNA clone ZM_BFc0100G09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455171.10.0hypothetical protein SORBIDRAFT_03g005480
TrEMBLC5XP980.0C5XP98_SORBI; Putative uncharacterized protein Sb03g005480
STRINGSb03g005480.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Representative plantOGRP9281558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.24e-48MYB_related family protein